PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001520-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 271aa    MW: 31105.3 Da    PI: 8.1901
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001520-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.46.8e-171150342
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        i n+s r+ tf kR++g+lKK +ELS+LC+++ + ii+s+
  WALNUT_00001520-RA 11 ITNDSARKATFKKRKKGLLKKMSELSTLCAIQTCAIIYSP 50
                        89*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.189149IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-20160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-22295IPR002100Transcription factor, MADS-box
CDDcd002667.55E-19285No hitNo description
PRINTSPR004042.4E-7323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-161151IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MTRKKVNFAY ITNDSARKAT FKKRKKGLLK KMSELSTLCA IQTCAIIYSP YDLEPEVWPS  60
PLGAQSVIAR FKNMSEAEQS RKMMNQGSFL RQRITKFEEQ VKKQQRENRE REMTQVMYKS  120
LVGNQGLQNL GVVDLNDLGW LIEKTIDEID ERIKSLREQI MPPPQVVTAG TSRGHHDVYP  180
TNQENYGDAT KNIADMAMDV YTPNQQFMSM VPDVGYGLRN EDMAVSQNPQ WLAELLRTNE  240
NVGLGKNEDH MLPFSHNSNN STLWSTFDQF P
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVNFAYITNDSARKATFKKRK
22125KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FJK31e-54AGL80_ARATH; Agamous-like MADS-box protein AGL80
STRINGPOPTR_0005s00420.12e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-50AGAMOUS-like 80